Lineage for d3d4ja1 (3d4j A:8-193)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931010Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries)
  8. 2931034Domain d3d4ja1: 3d4j A:8-193 [208989]
    Other proteins in same PDB: d3d4ja2, d3d4jb2
    automated match to d1fi4a1
    complexed with so4

Details for d3d4ja1

PDB Entry: 3d4j (more details), 2.4 Å

PDB Description: Crystal structure of Human mevalonate diphosphate decarboxylase
PDB Compounds: (A:) Diphosphomevalonate decarboxylase

SCOPe Domain Sequences for d3d4ja1:

Sequence, based on SEQRES records: (download)

>d3d4ja1 d.14.1.0 (A:8-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdftedriwl
ngreedvgqprlqaclreirclarkrrnsrdgdplpsslsckvhvasvnnfptaaglass
aagyaclaytlarvygvesdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqva
peshwp

Sequence, based on observed residues (ATOM records): (download)

>d3d4ja1 d.14.1.0 (A:8-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdftedriwl
ngreedvgqprlqaclreirclarsckvhvasvnnfptaaglassaagyaclaytlarvy
gvesdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqvapeshwp

SCOPe Domain Coordinates for d3d4ja1:

Click to download the PDB-style file with coordinates for d3d4ja1.
(The format of our PDB-style files is described here.)

Timeline for d3d4ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d4ja2