Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Cardiac myosin binding protein C, different domains [89185] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89186] (5 PDB entries) Uniprot Q14896 358-451, 641-770 |
Domain d3cx2a_: 3cx2 A: [173520] automated match to d2avga1 |
PDB Entry: 3cx2 (more details), 1.3 Å
SCOPe Domain Sequences for d3cx2a_:
Sequence, based on SEQRES records: (download)
>d3cx2a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe
>d3cx2a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} ddpiglfvmrpqdgevtvggsitfsarvagallkppvvkwfkgkwvdlsskvgqhlqlhd sydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe
Timeline for d3cx2a_: