Lineage for d3crna_ (3crn A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.0: automated matches [191324] (1 protein)
not a true familyProtein automated matches [190131] (59 species)
not a true protein
Species Methanospirillum hungatei [TaxId:323259] [188365] (2 PDB entries) 
Domain d3crna_: 3crn A: [199203]
automated match to d3crnb_
complexed with gol, na
Details for d3crna_
PDB Entry: 3crn (more details), 1.58 Å
PDB Description: crystal structure of response regulator receiver domain protein (chey- like) from methanospirillum hungatei jf-1
PDB Compounds: (A:) Response regulator receiver domain protein, CheY-likeSCOPe Domain Sequences for d3crna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3crna_ c.23.1.0 (A:) automated matches {Methanospirillum hungatei [TaxId: 323259]}
lkrilivdddtaildstkqilefegyeveiaatageglakieneffnlalfdiklpdmeg
tellekahklrpgmkkimvtgyaslensvfslnagadayimkpvnprdllekikekldeq
ekeghhhhh
SCOPe Domain Coordinates for d3crna_:
Click to download the PDB-style file with coordinates for d3crna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3crna_:
- d3crna_ first appeared in SCOPe 2.03
- d3crna_ appears in SCOPe 2.04
- d3crna_ is called d3crna1 in SCOPe 2.06
- d3crna_ appears in the current release, SCOPe 2.08, called d3crna1
View in 3D
