Lineage for d3cm8a_ (3cm8 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2223731Fold e.77: PA C-terminal domain-like [254112] (1 superfamily)
    Pfam PF00603; PubMed 18615018; complex fold with N-terminal a+b domain and C-terminal all-a domain
  4. 2223732Superfamily e.77.1: PA C-terminal domain-like [254132] (1 family) (S)
  5. 2223733Family e.77.1.1: PA C-terminal domain-like [254167] (2 protein domains)
  6. 2223734Protein PA C-terminal domain [254376] (1 species)
  7. 2223735Species Influenza A virus [TaxId:93838] [254809] (1 PDB entry)
  8. 2223736Domain d3cm8a_: 3cm8 A: [245508]
    protein/RNA complex

Details for d3cm8a_

PDB Entry: 3cm8 (more details), 2.9 Å

PDB Description: A RNA polymerase subunit structure from virus
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d3cm8a_:

Sequence, based on SEQRES records: (download)

>d3cm8a_ e.77.1.1 (A:) PA C-terminal domain {Influenza A virus [TaxId: 93838]}
iepflkttprplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmktffg
wkepnivkphekginpnyllawkqvlaelqdieneekipktknmrktsqlkwalgenmap
ekvdfedckdvsdlrqydsdepkprslaswiqsefnkaceltdsswieldeigedvapie
hiasmrrnyftaevshcrateyimkgvyintallnascaamddfqlipmiskcrtkegrr
ktnlygfiikgrshlrndtdvvnfvsmefsltdprlephkwekycvleigdmllrtaigq
vsrpmflyvrtngtskikmkwgmemrrcllqslqqiesmieaessvkekdmtkeffenks
etwpigespkgmeegsigkvcrtllaksvfnslyaspqlegfsaesrklllivqalrdnl
epgtfdlgglyeaieeclindpwvllnaswfnsflthalk

Sequence, based on observed residues (ATOM records): (download)

>d3cm8a_ e.77.1.1 (A:) PA C-terminal domain {Influenza A virus [TaxId: 93838]}
iepflkttprplrlpdgppcsqrskfllmdalklsieiplydaikcmktffgwkepnivk
phekginpnyllawkqvlaelqdieneekipktknmrktsqlkwalgenmapekvdfedc
kdvsepkprslaswiqsefnkaceltdsswieldeiiasmrrnyftaevshcrateyimk
gvyintallnascaamddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdvvnfv
smefsltdprlephkwekycvleigdmllrtaigqvsrpmflyvrtngtskikmkwgmem
rrcllqslqqiesmieaessvkekdmtkeffenksetwpigespkgmeegsigkvcrtll
aksvfnslyaspqlegfsaesrklllivqalrdnlepgtfdlgglyeaieeclindpwvl
lnaswfnsflthalk

SCOPe Domain Coordinates for d3cm8a_:

Click to download the PDB-style file with coordinates for d3cm8a_.
(The format of our PDB-style files is described here.)

Timeline for d3cm8a_: