SCOPe 2.06: Domain d3ckyd1: 3cky D:9-166

Lineage for d3ckyd1 (3cky D:9-166)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.0: automated matches [191313] (1 protein)
not a true family
Protein automated matches [190069] (239 species)
not a true protein
Species Eubacterium barkeri [TaxId:1528] [225505] (1 PDB entry)
Domain d3ckyd1: 3cky D:9-166 [208896]
Other proteins in same PDB: d3ckya2, d3ckyb2, d3ckyc2, d3ckyd2
automated match to d2cvza2

Details for d3ckyd1

PDB Entry: 3cky (more details), 2.3 Å

PDB Description: Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation

PDB Compounds: (D:) 2-hydroxymethyl glutarate dehydrogenase

SCOPe Domain Sequences for d3ckyd1:

Sequence, based on SEQRES records: (download)

>d3ckyd1 c.2.1.0 (D:9-166) automated matches {Eubacterium barkeri [TaxId: 1528]}
figlgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaasdiiftsl
pnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyvdapvsggt
kgaeagtltimvgaseavfekiqpvlsvigkdiyhvgd

Sequence, based on observed residues (ATOM records): (download)

>d3ckyd1 c.2.1.0 (D:9-166) automated matches {Eubacterium barkeri [TaxId: 1528]}
figlgaqkvaaasdiiftslpnagivetvmntvivdmssvspsstlkmakvaaekgidyv
dapvsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgd

SCOPe Domain Coordinates for d3ckyd1:

Click to download the PDB-style file with coordinates for d3ckyd1.
(The format of our PDB-style files is described here.)

Timeline for d3ckyd1: