Lineage for d3cbha_ (3cbh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850483Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2850484Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 proteins)
    Pfam PF01341
  6. 2850485Protein Cellobiohydrolase II (Cel6) [51993] (3 species)
  7. 2850501Species Trichoderma reesei, Cel6a [TaxId:51453] [51994] (7 PDB entries)
  8. 2850504Domain d3cbha_: 3cbh A: [30665]
    CA-atoms only

Details for d3cbha_

PDB Entry: 3cbh (more details), 2 Å

PDB Description: three-dimensional structure of cellobiohydrolase from trichoderma reesei
PDB Compounds: (A:) cellobiohydrolase II core protein

SCOPe Domain Sequences for d3cbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbha_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]}
sgtatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldkt
plmeqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidti
rqivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamyl
daghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgna
vyneklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsan
tgdslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltna
npsfl

SCOPe Domain Coordinates for d3cbha_:

Click to download the PDB-style file with coordinates for d3cbha_.
(The format of our PDB-style files is described here.)

Timeline for d3cbha_: