Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins) |
Protein automated matches [226969] (3 species) not a true protein |
Species Dengue virus 2 thailand/16681/84 [TaxId:31634] [231875] (2 PDB entries) |
Domain d3c5xa1: 3c5x A:1-297 [231876] Other proteins in same PDB: d3c5xa2, d3c5xa3 automated match to d1ok8a2 protein/RNA complex; complexed with bma, shd |
PDB Entry: 3c5x (more details), 2.2 Å
SCOPe Domain Sequences for d3c5xa1:
Sequence, based on SEQRES records: (download)
>d3c5xa1 f.10.1.1 (A:1-297) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]} mrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkggivtcamfr ckknmegkvvqpenleytivitphsgeehavgndtgkhgkeikitpqssiteaeltgygt vtmecsprtgldfnemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
>d3c5xa1 f.10.1.1 (A:1-297) automated matches {Dengue virus 2 thailand/16681/84 [TaxId: 31634]} mrcigmsnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgepslneeqdkrfvckhsmvdrgwgngcglfgkggivtcamfr ckknmegkvvqpenleytivitphsgeehgkhgkeikitpqssiteaeltgygtvtmecs prglfnemvllqmenkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknphakkq dvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d3c5xa1: