Lineage for d3c3ka_ (3c3k A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
parallel beta-sheet of 6 strands, order 213456Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) 
Similar in architecture to the superfamily II but partly differs in topology
Family c.93.1.0: automated matches [191439] (1 protein)
not a true familyProtein automated matches [190646] (60 species)
not a true protein
Species Actinobacillus succinogenes [TaxId:339671] [188337] (1 PDB entry) 
Domain d3c3ka_: 3c3k A: [173018]
automated match to d1sxga_
complexed with cl, gol
Details for d3c3ka_
PDB Entry: 3c3k (more details), 1.99 Å
PDB Description: crystal structure of an uncharacterized protein from actinobacillus succinogenes
PDB Compounds: (A:) alanine racemaseSCOPe Domain Sequences for d3c3ka_:
Sequence, based on SEQRES records: (download)
>d3c3ka_ c.93.1.0 (A:) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
ktgmllvmvsnianpfcaavvkgiektaekngyrillcntesdlarsrscltllsgkmvd
gvitmdalselpelqniigafpwvqcaeydplstvssvsiddvaaseyvvdqlvksgkkr
ialinhdlayqyaqhresgylnrlkfhgldysrisyaenldymagklatfsllksavkpd
aifaisdvlaagaiqaltesglsipqdvavvgfdgvdisqitvpalttvqqpseqigmka
vsllleqihsdvlaktvhhllpwkfvrrqsse
Sequence, based on observed residues (ATOM records): (download)
>d3c3ka_ c.93.1.0 (A:) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
ktgmllvmvsnianpfcaavvkgiektaekngyrillcntesdlarsrscltllsgkmvd
gvitmdalselpelqniigafpwvqcaeydplstvssvsiddvaaseyvvdqlvksgkkr
ialinhdlayqyaqhresgylnrlkfhgldysrisyaenldymagklatfsllksavkpd
aifaisdvlaagaiqaltesglsipqdvavvgfdgvdisqitvpalttvqqpseqigmka
vsllleqihsdvhhllpwkfvrrqsse
SCOPe Domain Coordinates for d3c3ka_:
Click to download the PDB-style file with coordinates for d3c3ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3c3ka_:
- d3c3ka_ first appeared in SCOPe 2.01
- d3c3ka_ appears in SCOPe 2.04
- d3c3ka_ is called d3c3ka1 in SCOPe 2.06
- d3c3ka_ appears in the current release, SCOPe 2.08, called d3c3ka1
View in 3D
