Lineage for d3c22d_ (3c22 D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. Protein automated matches [190159] (21 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. Domain d3c22d_: 3c22 D: [208767]
    automated match to d3p5hc_
    complexed with ca, mg

Details for d3c22d_

PDB Entry: 3c22 (more details), 1.5 Å

PDB Description: Crystal structure of the carbohydrate recognition domain of human Langerin
PDB Compounds: (D:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3c22d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c22d_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywig
ltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdkt
flfickrpyvpsep

SCOPe Domain Coordinates for d3c22d_ are not available.

Timeline for d3c22d_:

Domains from other chains:
(mouse over for more information)
d3c22a_, d3c22b_, d3c22c_