Lineage for d3bzdb1 (3bzd B:2-116)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-keySuperfamily b.40.2: Bacterial enterotoxins [50203] (3 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) 
Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species) Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
Uniprot P23313
Domain d3bzdb1: 3bzd B:2-116 [231872]
Other proteins in same PDB: d3bzda_, d3bzdb2
automated match to d3seba1
complexed with so4
Details for d3bzdb1
PDB Entry: 3bzd (more details), 2.3 Å
PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
PDB Compounds: (B:) Enterotoxin type C-3SCOPe Domain Sequences for d3bzdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzdb1 b.40.2.2 (B:2-116) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
sqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkny
dkvktellnedlakkykdevvdvygsnyyvncyfsskdnvwwhgktcmyggitkh
SCOPe Domain Coordinates for d3bzdb1:
Click to download the PDB-style file with coordinates for d3bzdb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bzdb1:
- d3bzdb1 first appeared in SCOPe 2.03
- d3bzdb1 appears in SCOPe 2.05
- d3bzdb1 appears in SCOPe 2.07
- d3bzdb1 appears in the current release, SCOPe 2.08
View in 3D
