Lineage for d3byyb2 (3byy B:117-235)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
Uniprot P23313
Domain d3byyb2: 3byy B:117-235 [231873]
Other proteins in same PDB: d3byya_, d3byyb1
automated match to d1se4a2
complexed with so4
Details for d3byyb2
PDB Entry: 3byy (more details), 2.2 Å
PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
PDB Compounds: (B:) Enterotoxin type C-3SCOPe Domain Sequences for d3byyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3byyb2 d.15.6.1 (B:117-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
egnhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefns
spyetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk
SCOPe Domain Coordinates for d3byyb2:
Click to download the PDB-style file with coordinates for d3byyb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3byyb2:
- d3byyb2 first appeared in SCOPe 2.03
- d3byyb2 appears in SCOPe 2.04
- d3byyb2 appears in SCOPe 2.06
- d3byyb2 appears in the current release, SCOPe 2.08
View in 3D
