Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (12 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186980] (6 PDB entries) |
Domain d3bx2b_: 3bx2 B: [231868] automated match to d3q0mb_ protein/RNA complex; complexed with na, so4 |
PDB Entry: 3bx2 (more details), 2.84 Å
SCOPe Domain Sequences for d3bx2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bx2b_ a.118.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqyigsihslckdqhgcrflqkqldilgskaadaifeetkdytvelmtdsfgnyliqkll eevtteqrivltkissphfveislnphgtralqklieciktdeeaqivvdslrpytvqls kdlngnhviqkclqrlkpenfqfifdaisdscidiathrhgccvlqrcldhgtteqcdnl cdkllalvdkltldpfgnyvvqyiitkeaeknkydythkivhllkpraielsihkfgsnv iekilktaivsepmileilnnggetgiqsllndsygnyvlqtaldishkqndylykrlse ivapllvgpirntphgkriigml
Timeline for d3bx2b_: