Lineage for d3bw1a_ (3bw1 A:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.38: Sm-like fold [50181] (5 superfamilies)
core: barrel, open; n*=4, S*=8; meander; SH3-like topologySuperfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) 
Family b.38.1.0: automated matches [191538] (1 protein)
not a true familyProtein automated matches [190914] (4 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (1 PDB entry) 
Domain d3bw1a_: 3bw1 A: [172872]
automated match to d1i81d_
complexed with mpd, so4
Details for d3bw1a_
PDB Entry: 3bw1 (more details), 2.5 Å
PDB Description: crystal structure of homomeric yeast lsm3 exhibiting novel octameric ring organisation
PDB Compounds: (A:) U6 snRNA-associated Sm-like protein LSm3SCOPe Domain Sequences for d3bw1a_:
Sequence, based on SEQRES records: (download)
>d3bw1a_ b.38.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
serrcemvfirgdtvtlistpsedddgavei
Sequence, based on observed residues (ATOM records): (download)
>d3bw1a_ b.38.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhmetpldllklnldervyiklrgartlvgtlqafdshcnivlsdavetiyqlnneelse
serrcemvfirgdtvtlistpsavei
SCOPe Domain Coordinates for d3bw1a_:
Click to download the PDB-style file with coordinates for d3bw1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bw1a_:
- d3bw1a_ first appeared in SCOPe 2.01
- d3bw1a_ appears in SCOPe 2.03
- d3bw1a_ appears in the current release, SCOPe 2.08, called d3bw1a1
View in 3D
