Lineage for d3bi7a1 (3bi7 A:414-617)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1335534Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 1335535Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 1335742Family b.122.1.12: SRA domain-like [159368] (2 proteins)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 1335743Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 1335744Species Human (Homo sapiens) [TaxId:9606] [159370] (4 PDB entries)
    Uniprot Q96T88 409-615! Uniprot Q96T88 414-617
  8. 1335745Domain d3bi7a1: 3bi7 A:414-617 [155298]
    complexed with edo, so4, unl

Details for d3bi7a1

PDB Entry: 3bi7 (more details), 1.7 Å

PDB Description: Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3bi7a1:

Sequence, based on SEQRES records: (download)

>d3bi7a1 b.122.1.12 (A:414-617) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
psnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdhg
nfftytgsggrdlsgnkrtaeqscdqkltntnralalncfapindqegaeakdwrsgkpv
rvvrnvkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtke
gkdrikklgltmqypegylealan

Sequence, based on observed residues (ATOM records): (download)

>d3bi7a1 b.122.1.12 (A:414-617) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
psnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdhg
nfftytgsggscdqkltntnralalncfapindqegaeakdwrsgkpvrvvrnvkggkns
kyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtkegkdrikklgltm
qypegylealan

SCOPe Domain Coordinates for d3bi7a1:

Click to download the PDB-style file with coordinates for d3bi7a1.
(The format of our PDB-style files is described here.)

Timeline for d3bi7a1: