Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Rat (Rattus rattus) [TaxId:10117] [225551] (1 PDB entry) |
Domain d3b9kc1: 3b9k C:1-107 [199077] Other proteins in same PDB: d3b9ka_, d3b9kb_, d3b9kc2, d3b9ke_, d3b9kf_, d3b9kl2 automated match to d1c5da1 complexed with nag |
PDB Entry: 3b9k (more details), 2.7 Å
SCOPe Domain Sequences for d3b9kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9kc1 b.1.1.1 (C:1-107) automated matches {Rat (Rattus rattus) [TaxId: 10117]} dikmtqspaslsaslgdkvtitcqasqnidkyiawyqqkpgkaprqlihytstlvsgtps rfsgsgsgrdytfsissvesediasyyclqydtlytfgagtklelk
Timeline for d3b9kc1: