Lineage for d3b8za_ (3b8z A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) 
Family d.92.1.0: automated matches [191495] (1 protein)
not a true familyProtein automated matches [190805] (12 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188286] (26 PDB entries) 
Domain d3b8za_: 3b8z A: [172500]
automated match to d1r54a_
complexed with 294, ca, zn
Details for d3b8za_
PDB Entry: 3b8z (more details), 1.4 Å
PDB Description: high resolution crystal structure of the catalytic domain of adamts-5 (aggrecanase-2)
PDB Compounds: (A:) protein ADAMTS-5SCOPe Domain Sequences for d3b8za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b8za_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvlgd
kdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgmad
vgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmssil
tsidaskpwskctsatiteflddghgnclldlprkqi
SCOPe Domain Coordinates for d3b8za_:
Click to download the PDB-style file with coordinates for d3b8za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3b8za_:
- d3b8za_ first appeared in SCOPe 2.01
- d3b8za_ appears in SCOPe 2.03
- d3b8za_ appears in SCOPe 2.05
- d3b8za_ appears in the current release, SCOPe 2.08
View in 3D
