Lineage for d3b2ga_ (3b2g A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) 
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) Protein automated matches [190231] (14 species)
not a true protein
Species Leptolyngbya boryana [TaxId:1184] [195189] (1 PDB entry) 
Domain d3b2ga_: 3b2g A: [195191]
automated match to d1rfka_
complexed with fes
Details for d3b2ga_
PDB Entry: 3b2g (more details), 1.76 Å
PDB Description: Leptolyngbya boryana Ferredoxin
PDB Compounds: (A:) Ferredoxin-1SCOPe Domain Sequences for d3b2ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b2ga_ d.15.4.1 (A:) automated matches {Leptolyngbya boryana [TaxId: 1184]}
psfkvtlineteglnttievpddeyildaaeeqgidlpyscragacstcagkitagtvdq
sdqsfldddqiqagyvltcvayptsdctilthqeedly
SCOPe Domain Coordinates for d3b2ga_:
Click to download the PDB-style file with coordinates for d3b2ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3b2ga_:
- d3b2ga_ first appeared in SCOPe 2.02
- d3b2ga_ appears in SCOPe 2.07
View in 3D
