Lineage for d3ay6a_ (3ay6 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346668Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1347798Protein automated matches [190085] (38 species)
    not a true protein
  7. 1347836Species Bacillus megaterium [TaxId:1404] [195340] (5 PDB entries)
  8. 1347845Domain d3ay6a_: 3ay6 A: [195341]
    automated match to d1gcoa_
    complexed with bgc, cl, nai; mutant

Details for d3ay6a_

PDB Entry: 3ay6 (more details), 2.1 Å

PDB Description: crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose
PDB Compounds: (A:) Glucose 1-dehydrogenase 4

SCOPe Domain Sequences for d3ay6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ay6a_ c.2.1.2 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
hhmytdlkdkvvvitggstglgramavrfgqeeakvvinyynneeealdakkeveeaggq
aiivqgdvtkeedvvnlvqtaikefgtldvminnagvenpvpshelsldnwnkvidtnlt
gaflgsreaikyfvendikgnvinmssvhemipwplfvhyaaskggmklmtetlaleyap
kgirvnnigpgamntpinaekfadpvqradvesmipmgyigkpeevaavaaflassqasy
vtgitlfadggmtkypsfqfgrg

SCOPe Domain Coordinates for d3ay6a_:

Click to download the PDB-style file with coordinates for d3ay6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ay6a_: