Lineage for d3akea_ (3ake A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2481030Species Thermus thermophilus HB8 [TaxId:300852] [189850] (11 PDB entries)
  8. 2481031Domain d3akea_: 3ake A: [172217]
    automated match to d1kdoa_
    complexed with c5p, mg

Details for d3akea_

PDB Entry: 3ake (more details), 1.5 Å

PDB Description: crystal structure of cmp kinase in complex with cmp from thermus thermophilus hb8
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d3akea_:

Sequence, based on SEQRES records: (download)

>d3akea_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrgivtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllal
leglgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevppp
fvaegrdmgtavfpeaahkfyltaspevrawrrarerpqayeevlrdllrrderdkaqsa
papdalvldtggmtldevvawvlahirr

Sequence, based on observed residues (ATOM records): (download)

>d3akea_ c.37.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrgivtidgpsasgkssvarrvaaalgvpylssgllyraaaflalragvdpgdeegllal
leglgvrllaqaegnrvladgedltsflhtpevdrvvsavarlpgvrawvnrrlkevppp
fvaegrdmgtavfpeaahkfyltaspevrawrrarerpqayeevlrdllrrderdqsapa
pdalvldtggmtldevvawvlahirr

SCOPe Domain Coordinates for d3akea_:

Click to download the PDB-style file with coordinates for d3akea_.
(The format of our PDB-style files is described here.)

Timeline for d3akea_: