Lineage for d3ahza_ (3ahz A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1146973Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1146974Protein automated matches [190075] (30 species)
    not a true protein
  7. 1147020Species Neotermes koshunensis [TaxId:60586] [189411] (6 PDB entries)
  8. 1147025Domain d3ahza_: 3ahz A: [172187]
    automated match to d1wcga1
    complexed with gol, trs

Details for d3ahza_

PDB Entry: 3ahz (more details), 1.34 Å

PDB Description: Crystal structure of beta-glucosidase from termite Neotermes koshunensis in complex with Tris
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d3ahza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ahza_ c.1.8.0 (A:) automated matches {Neotermes koshunensis [TaxId: 60586]}
tvytfpdefklgaatasyqiegawdengkgpniwdtlthehpdyvvdgatgdiaddsyhl
ykedvkilkelgaqvyrfsiswarvlpeghdnivnqdgidyynnlinellangiepmvtm
yhwdlpqalqdlggwpnlvlakysenyarvlfknfgdrvklwltfnepltfmdgyaseig
mapsintpgigdylaahtvihahariyhlydqefraeqggkvgislninwcepatnsaed
rascenyqqfnlglyahpifteegdypavlkdrvsrnsadegytdsrlpqftaeeveyir
gthdflginfytallgksgvegyepsryrdsgviltqdaawpisasswlkvvpwgfrkel
nwikneynnppvfitengfsdygglndtgrvhyytehlkemlkaihedgvnvigytawsl
mdnfewlrgysekfgiyavdfedparpripkesakvlaeimntrkiperfrd

SCOPe Domain Coordinates for d3ahza_:

Click to download the PDB-style file with coordinates for d3ahza_.
(The format of our PDB-style files is described here.)

Timeline for d3ahza_: