Lineage for d3agje1 (3agj E:3-227)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1597928Species Aeropyrum pernix [TaxId:56636] [255746] (1 PDB entry)
  8. 1597931Domain d3agje1: 3agj E:3-227 [245146]
    Other proteins in same PDB: d3agja2, d3agja3, d3agjc2, d3agjc3, d3agje2, d3agje3, d3agjg2, d3agjg3
    automated match to d1skqa3
    complexed with gtp, mg

Details for d3agje1

PDB Entry: 3agj (more details), 2.3 Å

PDB Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
PDB Compounds: (E:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3agje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3agje1 c.37.1.0 (E:3-227) automated matches {Aeropyrum pernix [TaxId: 56636]}
ekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkm
keerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgef
eagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgy
qvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppak

SCOPe Domain Coordinates for d3agje1:

Click to download the PDB-style file with coordinates for d3agje1.
(The format of our PDB-style files is described here.)

Timeline for d3agje1:

  • d3agje1 is new in SCOPe 2.04-stable
  • d3agje1 does not appear in SCOPe 2.05