Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Aeropyrum pernix [TaxId:56636] [255746] (1 PDB entry) |
Domain d3agje1: 3agj E:3-227 [245146] Other proteins in same PDB: d3agja2, d3agja3, d3agjc2, d3agjc3, d3agje2, d3agje3, d3agjg2, d3agjg3 automated match to d1skqa3 complexed with gtp, mg |
PDB Entry: 3agj (more details), 2.3 Å
SCOPe Domain Sequences for d3agje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3agje1 c.37.1.0 (E:3-227) automated matches {Aeropyrum pernix [TaxId: 56636]} ekphmnlvvighvdhgkstlvghllyrlgyieekklkeleeqaksrgkesfkfawildkm keerergitidltfmkfetkkyvftiidapghrdfvknmitgasqadaailvvsarkgef eagmstegqtrehlllartmgieqiivavnkmdapdvnydqkryefvvsvlkkfmkglgy qvdkipfipvsawkgdnlierspnmpwyngptlvealdqlqppak
Timeline for d3agje1: