Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (16 species) not a true protein |
Species Aeropyrum pernix [TaxId:56636] [255747] (1 PDB entry) |
Domain d3agja2: 3agj A:228-322 [245141] Other proteins in same PDB: d3agja1, d3agja3, d3agjc1, d3agjc3, d3agje1, d3agje3, d3agjg1, d3agjg3 automated match to d1skqa1 complexed with gtp, mg |
PDB Entry: 3agj (more details), 2.3 Å
SCOPe Domain Sequences for d3agja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3agja2 b.43.3.0 (A:228-322) automated matches {Aeropyrum pernix [TaxId: 56636]} pvdkplripvqnvysipgagtvpvgrvetgvlrvgdkvvfmppgvvgevrsiemhyqqlq qaepgdnigfavrgvsksdikrgdvaghldkpptv
Timeline for d3agja2: