Lineage for d3ag3i_ (3ag3 I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025021Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
    automatically mapped to Pfam PF02937
  5. 3025022Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 3025023Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025024Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries)
  8. 3025027Domain d3ag3i_: 3ag3 I: [172099]
    Other proteins in same PDB: d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3h_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3t_, d3ag3u_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_
    automated match to d1occi_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3ag3i_

PDB Entry: 3ag3 (more details), 1.8 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Nitric Oxide-bound Fully Reduced State at 100 K
PDB Compounds: (I:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d3ag3i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag3i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOPe Domain Coordinates for d3ag3i_:

Click to download the PDB-style file with coordinates for d3ag3i_.
(The format of our PDB-style files is described here.)

Timeline for d3ag3i_: