Lineage for d3a0ja_ (3a0j A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
barrel, closed; n=5, S=8Protein automated matches [190915] (12 species)
not a true protein
Species Thermus thermophilus HB8 [TaxId:300852] [189282] (1 PDB entry) 
Domain d3a0ja_: 3a0j A: [171632]
automated match to d1hzaa_
Details for d3a0ja_
PDB Entry: 3a0j (more details), 1.65 Å
PDB Description: Crystal structure of cold shock protein 1 from Thermus thermophilus HB8
PDB Compounds: (A:) Cold shock proteinSCOPe Domain Sequences for d3a0ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0ja_ b.40.4.5 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mqkgrvkwfnaekgygfieregdtdvfvhytainakgfrtlnegdivtfdvepgrngkgp
qavnvtvveparr
SCOPe Domain Coordinates for d3a0ja_:
Click to download the PDB-style file with coordinates for d3a0ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3a0ja_:
- d3a0ja_ first appeared in SCOPe 2.01
- d3a0ja_ appears in SCOPe 2.07
View in 3D
