Lineage for d2zwma_ (2zwm A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) 
Protein automated matches [190177] (6 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [189041] (1 PDB entry) 
Domain d2zwma_: 2zwm A: [171563]
automated match to d1nxoa_
complexed with so4
Details for d2zwma_
PDB Entry: 2zwm (more details), 2.04 Å
PDB Description: Crystal structure of YycF receiver domain from Bacillus subtilis
PDB Compounds: (A:) Transcriptional regulatory protein yycFSCOPe Domain Sequences for d2zwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwma_ c.23.1.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
dkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkdg
vevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrql
SCOPe Domain Coordinates for d2zwma_:
Click to download the PDB-style file with coordinates for d2zwma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zwma_:
- d2zwma_ first appeared in SCOPe 2.01
- d2zwma_ appears in SCOPe 2.03
- d2zwma_ appears in SCOPe 2.05
- d2zwma_ appears in the current release, SCOPe 2.08
View in 3D
