Lineage for d2zt9b_ (2zt9 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3027982Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3028043Protein automated matches [254659] (2 species)
    not a true protein
  7. 3028047Species Nostoc sp. [TaxId:103690] [255732] (2 PDB entries)
  8. 3028049Domain d2zt9b_: 2zt9 B: [244986]
    Other proteins in same PDB: d2zt9a_, d2zt9f_, d2zt9h_
    automated match to d2e74b1
    complexed with bcr, cla, fes, hem, opc, sqd, umq

Details for d2zt9b_

PDB Entry: 2zt9 (more details), 3 Å

PDB Description: crystal structure of the cytochrome b6f complex from nostoc sp. pcc 7120
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d2zt9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zt9b_ f.32.1.1 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
mathkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpa
mtgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkf
qnpfrrpvattvflfgtlvtlwlgigaalpldksltlglf

SCOPe Domain Coordinates for d2zt9b_:

Click to download the PDB-style file with coordinates for d2zt9b_.
(The format of our PDB-style files is described here.)

Timeline for d2zt9b_: