Lineage for d2zgqa_ (2zgq A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781811Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)
  8. 1781818Domain d2zgqa_: 2zgq A: [231702]
    automated match to d1ww4a_
    mutant

Details for d2zgqa_

PDB Entry: 2zgq (more details), 1.9 Å

PDB Description: crystal structure of aal mutant l33a in p1 spacegroup
PDB Compounds: (A:) Anti-tumor lectin

SCOPe Domain Sequences for d2zgqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zgqa_ b.29.1.0 (A:) automated matches {Agrocybe aegerita [TaxId: 5400]}
mqgvniynisagtsvdlaapvttgdivtffssaanlnagagnpnnttlnlfaengayllh
iafrlqenviifnsrqpdgpwlveqrvsdvanqfagidgkamvtvfdhgdkyqvvinekt
viqytkqisgltsslsynateetsifstvveavtytglalehhhhhh

SCOPe Domain Coordinates for d2zgqa_:

Click to download the PDB-style file with coordinates for d2zgqa_.
(The format of our PDB-style files is described here.)

Timeline for d2zgqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zgqb_