Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcineurin B-like protein 2 [101182] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101183] (2 PDB entries) |
Domain d2zfda1: 2zfd A:32-214 [154406] automatically matched to d1uhna_ complexed with acy, ca |
PDB Entry: 2zfd (more details), 1.2 Å
SCOPe Domain Sequences for d2zfda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit ttf
Timeline for d2zfda1: