Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (45 species) not a true protein |
Species Streptomyces griseolus [TaxId:1909] [188416] (5 PDB entries) |
Domain d2zbza_: 2zbz A: [171144] automated match to d1cl6a_ complexed with hem, vdx; mutant |
PDB Entry: 2zbz (more details), 1.9 Å
SCOPe Domain Sequences for d2zbza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zbza_ a.104.1.0 (A:) automated matches {Streptomyces griseolus [TaxId: 1909]} tattpqttdapafpsnrscpyqlpdgyaqlrdtpgplhrvtlydgrqawvvtkheaarkl lgdprlssnrtddnfpatspafeavrespqafigldppehgtrrrmtiseftvkrikgmr peveevvhgfldemlaagptadlvsqfalpvpsmvicrllgvpyadheffqdaskrlvqs tdaqsaltarndlagyldglitqfqtepgaglvgalvadqlangeidreelistamllli aghettasmtslsvitlldhpeqyaalradrslvpgaveellrylaiadiaggrvatadi evegqliragegvivvnsianrdgtvyedpdaldihrsarhhlafgfgvhqclgqnlarl elevilnalmdrvptlrlavpveqlvlrpgttiqgvnelpvtwh
Timeline for d2zbza_: