Lineage for d2z5da1 (2z5d A:23-174)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) 
Species Human (Homo sapiens), E2 H [TaxId:9606] [143055] (1 PDB entry)
Uniprot P62256 4-155
Domain d2z5da1: 2z5d A:23-174 [171058]
complexed with na
Details for d2z5da1
PDB Entry: 2z5d (more details), 2.1 Å
PDB Description: human ubiquitin-conjugating enzyme e2 h
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 HSCOPe Domain Sequences for d2z5da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z5da1 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 H [TaxId: 9606]}
pspgkrrmdtdviklieskhevtilgglnefvvkfygpqgtpyeggvwkvrvdlpdkypf
kspsigfmnkifhpnideasgtvcldvinqtwtalydltnifesflpqllaypnpidpln
gdaaamylhrpeeykqkikeyiqkyateealk
SCOPe Domain Coordinates for d2z5da1:
Click to download the PDB-style file with coordinates for d2z5da1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2z5da1:
- d2z5da1 first appeared in SCOPe 2.01
- d2z5da1 appears in SCOPe 2.03
- d2z5da1 appears in SCOPe 2.05
- d2z5da1 appears in the current release, SCOPe 2.08
View in 3D
