Lineage for d2z43b2 (2z43 B:73-324)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
Protein DNA repair protein Rad51, catalytic domain [82412] (7 species) 
Species Sulfolobus solfataricus [TaxId:273057] [225378] (1 PDB entry) 
Domain d2z43b2: 2z43 B:73-324 [207770]
Other proteins in same PDB: d2z43b1, d2z43c1
automated match to d1pzna2
Details for d2z43b2
PDB Entry: 2z43 (more details), 1.93 Å
PDB Description: Structure of a twinned crystal of RadA
PDB Compounds: (B:) DNA repair and recombination protein radASCOPe Domain Sequences for d2z43b2:
Sequence, based on SEQRES records: (download)
>d2z43b2 c.37.1.11 (B:73-324) DNA repair protein Rad51, catalytic domain {Sulfolobus solfataricus [TaxId: 273057]}
fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
itnqvmarpdmfygdptvavgghtlyhvpgiriqlkksrgnrriarvvdaphlpegevvf
alteegirdaee
Sequence, based on observed residues (ATOM records): (download)
>d2z43b2 c.37.1.11 (B:73-324) DNA repair protein Rad51, catalytic domain {Sulfolobus solfataricus [TaxId: 273057]}
fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
itnqvpgiriqlkksrgnrriarvvdaphlpegevvfalteegirdaee
SCOPe Domain Coordinates for d2z43b2:
Click to download the PDB-style file with coordinates for d2z43b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2z43b2:
- d2z43b2 first appeared in SCOPe 2.03
- d2z43b2 appears in SCOPe 2.04
- d2z43b2 appears in SCOPe 2.06
- d2z43b2 appears in the current release, SCOPe 2.08
View in 3D
