Lineage for d2yzrb_ (2yzr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827589Species Methanocaldococcus jannaschii [TaxId:243232] [235508] (3 PDB entries)
  8. 2827595Domain d2yzrb_: 2yzr B: [264624]
    automated match to d4adua_
    complexed with cl

Details for d2yzrb_

PDB Entry: 2yzr (more details), 2.3 Å

PDB Description: Crystal structure of pyridoxine biosynthesis protein from Methanocaldococcus jannaschii
PDB Compounds: (B:) Pyridoxal biosynthesis lyase pdxS

SCOPe Domain Sequences for d2yzrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzrb_ c.1.2.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mvkhgvvmdvtnveqaqiaeeagavavmalervpadiraaggvarmsdpalieeimdavs
ipvmakcrighttealvleaigvdmidesevltqadpffhiykkkfnvpfvcgarnlgea
vrriwegaamirtkgeagtgniveavrhmrlmneaiaqlqrmtdeevygvakfyanryae
laktvregmglpatvlenepiyegftlaeiidglyevllevkklgrlpvvnfaaggvatp
adaalmmqlgsdgvfvgsgifksenpleraraiveatynydkpdivaevsknlgeamkg

SCOPe Domain Coordinates for d2yzrb_:

Click to download the PDB-style file with coordinates for d2yzrb_.
(The format of our PDB-style files is described here.)

Timeline for d2yzrb_: