SCOPe 2.08: Domain d2yzca1: 2yzc A:11-141

Lineage for d2yzca1 (2yzc A:11-141)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.96: T-fold [55619] (2 superfamilies)
beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
tunnel-shaped: its known members form wide oligomeric barrels different sizes
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
bind purine or pterin in topologically similar sites between subunits
Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
automatically mapped to Pfam PF01014
Protein automated matches [254656] (4 species)
not a true protein
Species Arthrobacter globiformis [TaxId:1665] [255720] (5 PDB entries)
Domain d2yzca1: 2yzc A:11-141 [153854]
automated match to d2yzca1
complexed with 1al

Details for d2yzca1

PDB Entry: 2yzc (more details), 1.88 Å

PDB Description: Crystal structure of uricase from Arthrobacter globiformis in complex with allantoate

PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d2yzca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzca1 d.96.1.4 (A:11-141) automated matches {Arthrobacter globiformis [TaxId: 1665]}
tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
evrtavleisg

SCOPe Domain Coordinates for d2yzca1:

Click to download the PDB-style file with coordinates for d2yzca1.
(The format of our PDB-style files is described here.)

Timeline for d2yzca1: