![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:224324] [188415] (4 PDB entries) |
![]() | Domain d2yvla_: 2yvl A: [170884] automated match to d1o54a_ complexed with sam |
PDB Entry: 2yvl (more details), 2.2 Å
SCOPe Domain Sequences for d2yvla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvla_ c.66.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} nsfkegeyvlirfgekkflrkllpkqslsvkksvlkfdevigkpegvkingfevyrptle eiillgferktqiiypkdsfyialklnlnkekrvlefgtgsgallavlsevagevwtfea veefyktaqknlkkfnlgknvkffnvdfkdaevpegifhaafvdvrepwhylekvhkslm egapvgfllptanqvikllesienyfgnlevveilhrhyktiserfrpedqmvahtaylv fgrklkt
Timeline for d2yvla_: