Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
Protein automated matches [190234] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries) |
Domain d2yoab_: 2yoa B: [197129] Other proteins in same PDB: d2yoaa2 automated match to d1uova_ complexed with ca, scn, sep |
PDB Entry: 2yoa (more details), 1.5 Å
SCOPe Domain Sequences for d2yoab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yoab_ b.7.1.2 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw sdmlanprrpiaqwhtlqveeevdamlav
Timeline for d2yoab_: