Lineage for d2ynmb_ (2ynm B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1850255Species Prochlorococcus marinus [TaxId:1219] [255706] (1 PDB entry)
  8. 1850257Domain d2ynmb_: 2ynm B: [244790]
    automated match to d1cp2a_
    complexed with 1pe, adp, af3, epe, gol, k, mg, pmr, sf4

Details for d2ynmb_

PDB Entry: 2ynm (more details), 2.1 Å

PDB Description: Structure of the ADPxAlF3-Stabilized Transition State of the Nitrogenase-like Dark-Operative Protochlorophyllide Oxidoreductase Complex from Prochlorococcus marinus with Its Substrate Protochlorophyllide a
PDB Compounds: (B:) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein

SCOPe Domain Sequences for d2ynmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ynmb_ c.37.1.0 (B:) automated matches {Prochlorococcus marinus [TaxId: 1219]}
galviavygkggigksttssnlsaafsklgkkvlqigcdpkhdstftlthkmvptvidil
eevdfhseelrpqdfmfegfngvqcvesggppagtgcggyvtgqtvkllkehhlledtdv
vifdvlgdvvcggfaaplqhanyclivtandfdsifamnrivaainakaknykvrlggvi
anrsaeldqiekfnektglktmahfrnvdairrsrlkkctifemdpeeegvlevqneyls
lakkmidnvepleaeplkdreifdllgf

SCOPe Domain Coordinates for d2ynmb_:

Click to download the PDB-style file with coordinates for d2ynmb_.
(The format of our PDB-style files is described here.)

Timeline for d2ynmb_: