Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Prochlorococcus marinus [TaxId:1219] [255706] (1 PDB entry) |
Domain d2ynmb_: 2ynm B: [244790] automated match to d1cp2a_ complexed with 1pe, adp, af3, epe, gol, k, mg, pmr, sf4 |
PDB Entry: 2ynm (more details), 2.1 Å
SCOPe Domain Sequences for d2ynmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ynmb_ c.37.1.0 (B:) automated matches {Prochlorococcus marinus [TaxId: 1219]} galviavygkggigksttssnlsaafsklgkkvlqigcdpkhdstftlthkmvptvidil eevdfhseelrpqdfmfegfngvqcvesggppagtgcggyvtgqtvkllkehhlledtdv vifdvlgdvvcggfaaplqhanyclivtandfdsifamnrivaainakaknykvrlggvi anrsaeldqiekfnektglktmahfrnvdairrsrlkkctifemdpeeegvlevqneyls lakkmidnvepleaeplkdreifdllgf
Timeline for d2ynmb_: