Lineage for d2ykna2 (2ykn A:430-557)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.0: automated matches [191357] (1 protein)
not a true familyProtein automated matches [190396] (40 species)
not a true protein
Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (20 PDB entries) 
Domain d2ykna2: 2ykn A:430-557 [207661]
Other proteins in same PDB: d2ykna1, d2ykna3, d2yknb_
automated match to d1bqna1
complexed with ca, ykn
Details for d2ykna2
PDB Entry: 2ykn (more details), 2.12 Å
PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)
PDB Compounds: (A:) Reverse transcriptase/ribonuclease HSCOPe Domain Sequences for d2ykna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ykna2 c.55.3.0 (A:430-557) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktqlqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir
SCOPe Domain Coordinates for d2ykna2:
Click to download the PDB-style file with coordinates for d2ykna2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ykna2:
- d2ykna2 first appeared in SCOPe 2.03
- d2ykna2 appears in SCOPe 2.07
View in 3D
