Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein automated matches [190211] (5 species) not a true protein |
Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries) |
Domain d2ykna1: 2ykn A:1-429 [207660] Other proteins in same PDB: d2ykna2 automated match to d1bqna2 complexed with ca, ykn |
PDB Entry: 2ykn (more details), 2.12 Å
SCOPe Domain Sequences for d2ykna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ykna1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpystpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppllwmgyelhpdkwt vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp plvklwyql
Timeline for d2ykna1: