Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein automated matches [190132] (4 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [189706] (1 PDB entry) |
Domain d2y5ie_: 2y5i E: [170617] automated match to d1k2ha_ complexed with ca, ipa |
PDB Entry: 2y5i (more details), 2.03 Å
SCOPe Domain Sequences for d2y5ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y5ie_ a.39.1.2 (E:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} psklegamdalitvfhnysgsegdkyklskgelkellnaeltdflmsqkdpmlvekimnd ldsnkdnevdfnefvvlvaaltvacndffqeqqkkrs
Timeline for d2y5ie_: