Lineage for d2xvma_ (2xvm A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) 
Family c.66.1.44: TehB-like [142603] (2 proteins)
Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724)Protein automated matches [191226] (3 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [189643] (2 PDB entries) 
Domain d2xvma_: 2xvm A: [170423]
automated match to d2i6ga1
complexed with sah
Details for d2xvma_
PDB Entry: 2xvm (more details), 1.48 Å
PDB Description: crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sah
PDB Compounds: (A:) tellurite resistance protein tehbSCOPe Domain Sequences for d2xvma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xvma_ c.66.1.44 (A:) automated matches {Escherichia coli [TaxId: 562]}
amvirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawd
knamsianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglian
mqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtd
angnriklrfatmlarkk
SCOPe Domain Coordinates for d2xvma_:
Click to download the PDB-style file with coordinates for d2xvma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2xvma_:
- d2xvma_ first appeared in SCOPe 2.01
- d2xvma_ appears in SCOPe 2.04
- d2xvma_ is called d2xvma1 in SCOPe 2.06
- d2xvma_ appears in the current release, SCOPe 2.08, called d2xvma1
View in 3D
