Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.44: TehB-like [142603] (2 proteins) Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724) |
Protein automated matches [191226] (3 species) not a true protein |
Species Escherichia coli [TaxId:562] [189643] (2 PDB entries) |
Domain d2xvma_: 2xvm A: [170423] automated match to d2i6ga1 complexed with sah |
PDB Entry: 2xvm (more details), 1.48 Å
SCOPe Domain Sequences for d2xvma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xvma_ c.66.1.44 (A:) automated matches {Escherichia coli [TaxId: 562]} amvirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawd knamsianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglian mqrctkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtd angnriklrfatmlarkk
Timeline for d2xvma_: