Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [196380] (1 PDB entry) |
Domain d2xuah_: 2xua H: [196381] automated match to d3om8b_ complexed with shf |
PDB Entry: 2xua (more details), 1.9 Å
SCOPe Domain Sequences for d2xuah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xuah_ c.69.1.0 (H:) automated matches {Burkholderia xenovorans [TaxId: 266265]} mpyaavngtelhyridgerhgnapwivlsnslgtdlsmwapqvaalskhfrvlrydtrgh ghseapkgpytieqltgdvlglmdtlkiaranfcglsmggltgvalaarhadriervalc ntaarigspevwvpravkartegmhaladavlprwftadymerepvvlamirdvfvhtdk egyasnceaidaadlrpeapgikvpalvisgthdlaatpaqgrelaqaiagaryveldas hisnieradaftktvvdflte
Timeline for d2xuah_: