Lineage for d2xj5a_ (2xj5 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1497288Protein automated matches [190089] (7 species)
    not a true protein
  7. 1497289Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (25 PDB entries)
  8. 1497305Domain d2xj5a_: 2xj5 A: [170129]
    automated match to d1ebea_
    complexed with hem, mpd, po4

Details for d2xj5a_

PDB Entry: 2xj5 (more details), 1.68 Å

PDB Description: the structure of cytochrome c peroxidase compound ii
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2xj5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xj5a_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2xj5a_:

Click to download the PDB-style file with coordinates for d2xj5a_.
(The format of our PDB-style files is described here.)

Timeline for d2xj5a_: