Lineage for d2xhia1 (2xhi A:10-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975391Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 2975392Protein automated matches [227057] (4 species)
    not a true protein
  7. 2975406Species Human (Homo sapiens) [TaxId:9606] [226065] (2 PDB entries)
  8. 2975407Domain d2xhia1: 2xhi A:10-135 [207254]
    Other proteins in same PDB: d2xhia2
    automated match to d1m3qa2
    protein/DNA complex; complexed with ca; mutant

Details for d2xhia1

PDB Entry: 2xhi (more details), 1.55 Å

PDB Description: Separation-of-function mutants unravel the dual reaction mode of human 8-oxoguanine DNA glycosylase
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2xhia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhia1 d.129.1.0 (A:10-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqt
eeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqg
vrllrq

SCOPe Domain Coordinates for d2xhia1:

Click to download the PDB-style file with coordinates for d2xhia1.
(The format of our PDB-style files is described here.)

Timeline for d2xhia1:

2975407
d2xhia1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2xhia2