Lineage for d2xcza_ (2xcz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961595Species Prochlorococcus marinus [TaxId:74547] [189461] (1 PDB entry)
  8. 2961596Domain d2xcza_: 2xcz A: [170034]
    automated match to d1mfia_
    complexed with peg

Details for d2xcza_

PDB Entry: 2xcz (more details), 1.64 Å

PDB Description: crystal structure of macrophage migration inhibitory factor homologue from prochlorococcus marinus
PDB Compounds: (A:) possible atls1-like light-inducible protein

SCOPe Domain Sequences for d2xcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xcza_ d.80.1.0 (A:) automated matches {Prochlorococcus marinus [TaxId: 74547]}
pliniqasvpavadansllqelssklaellgkpekyvmtslqcgvpmtfsgnteptcyve
vksigaldgsrtqevselvcghieqnlgipadriyigfedvparlwgwngstfg

SCOPe Domain Coordinates for d2xcza_:

Click to download the PDB-style file with coordinates for d2xcza_.
(The format of our PDB-style files is described here.)

Timeline for d2xcza_: