Lineage for d2x71a_ (2x71 A:)
- Root: SCOPe 2.04
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) Protein automated matches [190161] (19 species)
not a true protein
Species Bacillus licheniformis [TaxId:1402] [188244] (9 PDB entries) 
Domain d2x71a_: 2x71 A: [169913]
automated match to d1i2wb_
complexed with eoh, l4c, so4
Details for d2x71a_
PDB Entry: 2x71 (more details), 2.1 Å
PDB Description: structural basis for the interaction of lactivicins with serine beta-lactamases
PDB Compounds: (A:) Beta-lactamaseSCOPe Domain Sequences for d2x71a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x71a_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvtyrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdntaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralatslqafaledklpsekrellidwmkr
nttgdaliragvpegwevadktgagsygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvvkal
SCOPe Domain Coordinates for d2x71a_:
Click to download the PDB-style file with coordinates for d2x71a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2x71a_:
- d2x71a_ first appeared in SCOPe 2.01
- d2x71a_ appears in SCOPe 2.03
- d2x71a_ appears in SCOPe 2.05
- d2x71a_ appears in the current release, SCOPe 2.08
View in 3D
