Class a: All alpha proteins [46456] (290 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (13 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [231531] (2 PDB entries) |
Domain d2x1la2: 2x1l A:354-512 [231532] Other proteins in same PDB: d2x1la1, d2x1lb2, d2x1lc2 automated match to d4eg3b2 protein/RNA complex; complexed with 2hp, adn, cxs, met |
PDB Entry: 2x1l (more details), 2.3 Å
SCOPe Domain Sequences for d2x1la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x1la2 a.27.1.0 (A:354-512) automated matches {Mycobacterium smegmatis [TaxId: 246196]} anelgnlaqrslsmvaknlgaavpdpgeftdedtallaaadallervrehfdvpamhlal eaiwsvlgaanryfsaqepwvlrksdaaedqqrfrtvlyttlevvriaslllqpvmpest aklldllgqptderdfsaianrikpgtslpapsgifpry
Timeline for d2x1la2:
View in 3D Domains from other chains: (mouse over for more information) d2x1lb1, d2x1lb2, d2x1lc1, d2x1lc2 |