Lineage for d2x1la2 (2x1l A:354-512)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705974Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2705975Protein automated matches [226872] (13 species)
    not a true protein
  7. 2706000Species Mycobacterium smegmatis [TaxId:246196] [231531] (2 PDB entries)
  8. 2706001Domain d2x1la2: 2x1l A:354-512 [231532]
    Other proteins in same PDB: d2x1la1, d2x1lb2, d2x1lc2
    automated match to d4eg3b2
    protein/RNA complex; complexed with 2hp, adn, cxs, met

Details for d2x1la2

PDB Entry: 2x1l (more details), 2.3 Å

PDB Description: crystal structure of mycobacterium smegmatis methionyl-trna synthetase in complex with methionine and adenosine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2x1la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x1la2 a.27.1.0 (A:354-512) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
anelgnlaqrslsmvaknlgaavpdpgeftdedtallaaadallervrehfdvpamhlal
eaiwsvlgaanryfsaqepwvlrksdaaedqqrfrtvlyttlevvriaslllqpvmpest
aklldllgqptderdfsaianrikpgtslpapsgifpry

SCOPe Domain Coordinates for d2x1la2:

Click to download the PDB-style file with coordinates for d2x1la2.
(The format of our PDB-style files is described here.)

Timeline for d2x1la2:

2706001
d2x1la2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2x1la1