Lineage for d2wyza_ (2wyz A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037424Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2037425Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2037438Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2037541Species Human (Homo sapiens) [TaxId:9606] [49333] (79 PDB entries)
  8. 2037596Domain d2wyza_: 2wyz A: [169719]
    automated match to d1hl4a_
    complexed with cu, so4, u5p, zn; mutant

Details for d2wyza_

PDB Entry: 2wyz (more details), 1.7 Å

PDB Description: l38v sod1 mutant complexed with ump
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2wyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wyza_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikgvteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d2wyza_:

Click to download the PDB-style file with coordinates for d2wyza_.
(The format of our PDB-style files is described here.)

Timeline for d2wyza_: