Lineage for d2wtlf_ (2wtl F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486513Species Mycobacterium tuberculosis [TaxId:83332] [196063] (2 PDB entries)
  8. 1486525Domain d2wtlf_: 2wtl F: [196492]
    automated match to d3bkna_
    complexed with fe, unl, unx

Details for d2wtlf_

PDB Entry: 2wtl (more details), 2.59 Å

PDB Description: crystal structure of bfra from m. tuberculosis
PDB Compounds: (F:) bacterioferritin

SCOPe Domain Sequences for d2wtlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtlf_ a.25.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitdr
illldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavlle
kivadeeehidyletqlelmdklgeelysaqcvsrpptsaw

SCOPe Domain Coordinates for d2wtlf_:

Click to download the PDB-style file with coordinates for d2wtlf_.
(The format of our PDB-style files is described here.)

Timeline for d2wtlf_: