Lineage for d2wpis_ (2wpi S:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) 
Protein Coagulation factor IXa, protease domain [50583] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50585] (21 PDB entries) 
Domain d2wpis_: 2wpi S: [169544]
Other proteins in same PDB: d2wpie_
automated match to d1rfna_
complexed with ca; mutant
Details for d2wpis_
PDB Entry: 2wpi (more details), 1.99 Å
PDB Description: factor ixa superactive double mutant
PDB Compounds: (S:) Coagulation factor IXa heavy chainSCOPe Domain Sequences for d2wpis_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wpis_ b.47.1.2 (S:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt
SCOPe Domain Coordinates for d2wpis_:
Click to download the PDB-style file with coordinates for d2wpis_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wpis_:
- d2wpis_ first appeared in SCOPe 2.01
- d2wpis_ appears in SCOPe 2.07
View in 3D
